3.80 Rating by CuteStat

saraswatiadhyapakvidhyalaydeled.org is 4 years 8 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, saraswatiadhyapakvidhyalaydeled.org is SAFE to browse.

PageSpeed Score
52
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 9,630
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.168.131.241

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.168.131.241)

ImageShack - Best place for all of your image hosting and image sharin

- yfrog.com

Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.

7,257,358 $ 240.00

ReadWrite - The Blog of Things

- readwriteweb.com

The Blog of Things

85,240 $ 170,640.00

مجلة سيدتي | الصفحة الرئيسية

- sedty.com

سيدتي نت موقع لمجلة المرأة العربية يطرح قضايا ونصائح خاصة بالمرأة والمجتمع في مختلف المجالات. سواء في الصحة، التغذية، الجمال، الأزياء، الرشاقة، المطبخ والأطفال.

9,553,871 $ 240.00

The Best YouTube to MP3 Converter - IXConverter.com

- bestvideodownloader.com

Download and Convert your favorite online videos and audio to MP3, MP4, WEBM, F4V, and 3GP formats for free!

Not Applicable $ 8.95

Haber365 | Haber, Haberler, Son Dakika Haberleri

- haber365.com

Haber365, güncel haberler, haber, en son haber, son dakika haberler ve 365 gün tüm kategorilerde güncel gelişmeler haber sitesi Haber365.com.tr'de.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.12.2
Date: Fri, 23 Aug 2019 19:48:33 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: Aug 23, 2019, 12:00 AM 4 years 8 months 3 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited
serverTransferProhibited
addPeriod

Domain Nameserver Information

Host IP Address Country
ns11.domaincontrol.com 97.74.105.6 United States of America United States of America
ns12.domaincontrol.com 173.201.73.6 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
saraswatiadhyapakvidhyalaydeled.org A 600 IP: 184.168.131.241
saraswatiadhyapakvidhyalaydeled.org NS 3600 Target: ns11.domaincontrol.com
saraswatiadhyapakvidhyalaydeled.org NS 3600 Target: ns12.domaincontrol.com
saraswatiadhyapakvidhyalaydeled.org SOA 600 MNAME: ns11.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019082306
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600

Full WHOIS Lookup

Domain Name: SARASWATIADHYAPAKVIDHYALAYDELED.ORG
Registry Domain ID: D402200000011242784-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-08-23T11:44:30Z
Creation Date: 2019-08-23T11:44:28Z
Registry Expiry Date: 2020-08-23T11:44:28Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS11.DOMAINCONTROL.COM
Name Server: NS12.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2019-08-23T19:47:41Z