Web Analysis for Saraswatiadhyapakvidhyalaydeled - saraswatiadhyapakvidhyalaydeled.org
saraswatiadhyapakvidhyalaydeled.org is 4 years 8 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, saraswatiadhyapakvidhyalaydeled.org is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 9,630 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.168.131.241)
ImageShack - Best place for all of your image hosting and image sharin
Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.
مجلة سيدتي | الصفحة الرئيسية
سيدتي نت موقع لمجلة المرأة العربية يطرح قضايا ونصائح خاصة بالمرأة والمجتمع في مختلف المجالات. سواء في الصحة، التغذية، الجمال، الأزياء، الرشاقة، المطبخ والأطفال.
The Best YouTube to MP3 Converter - IXConverter.com
Download and Convert your favorite online videos and audio to MP3, MP4, WEBM, F4V, and 3GP formats for free!
Haber365 | Haber, Haberler, Son Dakika Haberleri
Haber365, güncel haberler, haber, en son haber, son dakika haberler ve 365 gün tüm kategorilerde güncel gelişmeler haber sitesi Haber365.com.tr'de.
HTTP Header Analysis
Server: nginx/1.12.2
Date: Fri, 23 Aug 2019 19:48:33 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns11.domaincontrol.com | 97.74.105.6 | United States of America | |
ns12.domaincontrol.com | 173.201.73.6 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
saraswatiadhyapakvidhyalaydeled.org | A | 600 |
IP: 184.168.131.241 |
saraswatiadhyapakvidhyalaydeled.org | NS | 3600 |
Target: ns11.domaincontrol.com |
saraswatiadhyapakvidhyalaydeled.org | NS | 3600 |
Target: ns12.domaincontrol.com |
saraswatiadhyapakvidhyalaydeled.org | SOA | 600 |
MNAME: ns11.domaincontrol.com RNAME: dns.jomax.net Serial: 2019082306 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
Full WHOIS Lookup
Registry Domain ID: D402200000011242784-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2019-08-23T11:44:30Z
Creation Date: 2019-08-23T11:44:28Z
Registry Expiry Date: 2020-08-23T11:44:28Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS11.DOMAINCONTROL.COM
Name Server: NS12.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2019-08-23T19:47:41Z